PDB entry 1xfg

View 1xfg on RCSB PDB site
Description: Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate
Class: transferase
Keywords: glutamine amidotransferase; n-terminal nucleophile
Deposited on 2004-09-14, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.159
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Escherichia coli [TaxId:562]
    Gene: GLMS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfga_
  • Chain 'B':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Escherichia coli [TaxId:562]
    Gene: GLMS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfgb_
  • Heterogens: NA, ACT, HGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xfgA (A:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfgA (A:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xfgB (B:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfgB (B:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlq