PDB entry 1xff

View 1xff on RCSB PDB site
Description: Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate
Class: transferase
Keywords: complex (transferase/inhibitor); glutamine amidotransferase
Deposited on 2004-09-14, released 2004-09-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-09-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Escherichia coli
    Gene: GLMS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xffa_
  • Chain 'B':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Escherichia coli
    Gene: GLMS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xffb_
  • Heterogens: NA, ACT, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xffA (A:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xffA (A:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xffB (B:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xffB (B:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlq