PDB entry 1xfe

View 1xfe on RCSB PDB site
Description: Solution structure of the LA7-EGFA pair from the LDL receptor
Class: lipid transport, endocytosis/exocytosis
Keywords: ligand-binding repeat, EGF-like repeat, LIPID TRANSPORT, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2004-09-14, released 2004-11-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: LDLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01130 (1-82)
      • cloning artifact (0)
    Domains in SCOPe 2.01: d1xfea1, d1xfea2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xfeA (A:)
    gnvtlcegpnkfkchsgecitldkvcnmardcrdwsdepikecgtnecldnnggcshvcn
    dlkigyeclcpdgfqlvaqrrce