PDB entry 1xfd

View 1xfd on RCSB PDB site
Description: Structure of a human A-type Potassium Channel Accelerating factor DPPX, a member of the dipeptidyl aminopeptidase family
Class: membrane protein
Keywords: DPPX; DPP6; Kv4; Kv; KAF, MEMBRANE PROTEIN
Deposited on 2004-09-14, released 2004-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dipeptidyl aminopeptidase-like protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: DPPX
    Database cross-references and differences (RAF-indexed):
    • GB NP_570629 (0-722)
    Domains in SCOPe 2.06: d1xfda1, d1xfda2
  • Chain 'B':
    Compound: Dipeptidyl aminopeptidase-like protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: DPPX
    Database cross-references and differences (RAF-indexed):
    • GB NP_570629 (0-722)
    Domains in SCOPe 2.06: d1xfdb1, d1xfdb2
  • Chain 'C':
    Compound: Dipeptidyl aminopeptidase-like protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: DPPX
    Database cross-references and differences (RAF-indexed):
    • GB NP_570629 (0-722)
    Domains in SCOPe 2.06: d1xfdc1, d1xfdc2
  • Chain 'D':
    Compound: Dipeptidyl aminopeptidase-like protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: DPPX
    Database cross-references and differences (RAF-indexed):
    • GB NP_570629 (0-722)
    Domains in SCOPe 2.06: d1xfdd1, d1xfdd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xfdA (A:)
    qkkkvtvedlfsedfkihdpeakwisdtefiyreqkgtvrlwnvetntstvliegkkies
    lrairyeispdreyalfsynvepiyqhsytgyyvlskiphgdpqsldppevsnaklqyag
    wgpkgqqlififenniyycahvgkqairvvstgkegviynglsdwlyeeeilkthiahww
    spdgtrlayaaindsrvpimelptytgsiyptvkpyhypkagsenpsislhviglngpth
    dlemmppddprmreyyitmvkwatstkvavtwlnraqnvsiltlcdattgvctkkhedes
    eawlhrqneepvfskdgrkfffiraipqggrgkfyhitvsssqpnssndniqsitsgdwd
    vtkilaydekgnkiyflstedlprrrqlysantvgnfnrqclscdlvenctyfsasfshs
    mdffllkcegpgvpmvtvhnttdkkkmfdletnehvkkaindrqmpkveyrdieiddynl
    pmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvsshgavvvkcdgrgsg
    fqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgkdyggylstyilpakg
    enqgqtftcgsalspitdfklyasafserylglhgldnrayemtkvahrvsaleeqqfli
    ihptadekihfqhtaelitqlirgkanyslqiypdeshyftssslkqhlyrsiinffvec
    fri
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xfdB (B:)
    qkkkvtvedlfsedfkihdpeakwisdtefiyreqkgtvrlwnvetntstvliegkkies
    lrairyeispdreyalfsynvepiyqhsytgyyvlskiphgdpqsldppevsnaklqyag
    wgpkgqqlififenniyycahvgkqairvvstgkegviynglsdwlyeeeilkthiahww
    spdgtrlayaaindsrvpimelptytgsiyptvkpyhypkagsenpsislhviglngpth
    dlemmppddprmreyyitmvkwatstkvavtwlnraqnvsiltlcdattgvctkkhedes
    eawlhrqneepvfskdgrkfffiraipqggrgkfyhitvsssqpnssndniqsitsgdwd
    vtkilaydekgnkiyflstedlprrrqlysantvgnfnrqclscdlvenctyfsasfshs
    mdffllkcegpgvpmvtvhnttdkkkmfdletnehvkkaindrqmpkveyrdieiddynl
    pmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvsshgavvvkcdgrgsg
    fqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgkdyggylstyilpakg
    enqgqtftcgsalspitdfklyasafserylglhgldnrayemtkvahrvsaleeqqfli
    ihptadekihfqhtaelitqlirgkanyslqiypdeshyftssslkqhlyrsiinffvec
    fri
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xfdC (C:)
    qkkkvtvedlfsedfkihdpeakwisdtefiyreqkgtvrlwnvetntstvliegkkies
    lrairyeispdreyalfsynvepiyqhsytgyyvlskiphgdpqsldppevsnaklqyag
    wgpkgqqlififenniyycahvgkqairvvstgkegviynglsdwlyeeeilkthiahww
    spdgtrlayaaindsrvpimelptytgsiyptvkpyhypkagsenpsislhviglngpth
    dlemmppddprmreyyitmvkwatstkvavtwlnraqnvsiltlcdattgvctkkhedes
    eawlhrqneepvfskdgrkfffiraipqggrgkfyhitvsssqpnssndniqsitsgdwd
    vtkilaydekgnkiyflstedlprrrqlysantvgnfnrqclscdlvenctyfsasfshs
    mdffllkcegpgvpmvtvhnttdkkkmfdletnehvkkaindrqmpkveyrdieiddynl
    pmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvsshgavvvkcdgrgsg
    fqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgkdyggylstyilpakg
    enqgqtftcgsalspitdfklyasafserylglhgldnrayemtkvahrvsaleeqqfli
    ihptadekihfqhtaelitqlirgkanyslqiypdeshyftssslkqhlyrsiinffvec
    fri
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xfdD (D:)
    qkkkvtvedlfsedfkihdpeakwisdtefiyreqkgtvrlwnvetntstvliegkkies
    lrairyeispdreyalfsynvepiyqhsytgyyvlskiphgdpqsldppevsnaklqyag
    wgpkgqqlififenniyycahvgkqairvvstgkegviynglsdwlyeeeilkthiahww
    spdgtrlayaaindsrvpimelptytgsiyptvkpyhypkagsenpsislhviglngpth
    dlemmppddprmreyyitmvkwatstkvavtwlnraqnvsiltlcdattgvctkkhedes
    eawlhrqneepvfskdgrkfffiraipqggrgkfyhitvsssqpnssndniqsitsgdwd
    vtkilaydekgnkiyflstedlprrrqlysantvgnfnrqclscdlvenctyfsasfshs
    mdffllkcegpgvpmvtvhnttdkkkmfdletnehvkkaindrqmpkveyrdieiddynl
    pmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvsshgavvvkcdgrgsg
    fqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgkdyggylstyilpakg
    enqgqtftcgsalspitdfklyasafserylglhgldnrayemtkvahrvsaleeqqfli
    ihptadekihfqhtaelitqlirgkanyslqiypdeshyftssslkqhlyrsiinffvec
    fri