PDB entry 1xfc

View 1xfc on RCSB PDB site
Description: The 1.9 A crystal structure of alanine racemase from Mycobacterium tuberculosis contains a conserved entryway into the active site
Deposited on 2004-09-14, released 2005-08-16
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alanine racemase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: alr
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: alanine racemase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: alr
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xfcA (A:)
    mtpisqtpgllaeamvdlgaiehnvrvlrehaghaqlmavvkadgyghgatrvaqtalga
    gaaelgvatvdealalradgitapvlawlhppgidfgpalladvqvavsslrqldellha
    vrrtgrtatvtvkvdtglnrngvgpaqfpamltalrqamaedavrlrglmshmvyadkpd
    dsindvqaqrftaflaqareqgvrfevahlsnssatmarpdltfdlvrpgiavyglspvp
    algdmglvpamtvkcavalvksiragegvsyghtwiaprdtnlallpigyadgvfrslgg
    rlevlingrrcpgvgricmdqfmvdlgpgpldvaegdeailfgpgirgeptaqdwadlvg
    tihyevvtsprgritrtyreaenr
    

    Sequence, based on observed residues (ATOM records):
    >1xfcA (A:)
    laeamvdlgaiehnvrvlrehaghaqlmavvkadgyghgatrvaqtalgagaaelgvatv
    dealalradgitapvlawlhppgidfgpalladvqvavsslrqldellhavrrtgrtatv
    tvkvdtglnrngvgpaqfpamltalrqamaedavrlrglmshmpddsindvqaqrftafl
    aqareqgvrfevahlsnssatmarpdltfdlvrpgiavyglspvpalgdmglvpamtvkc
    avalvksiragegvsyghtwiaprdtnlallpigyadgvfrslggrlevlingrrcpgvg
    ricmdqfmvdlgpgpldvaegdeailfgpgirgeptaqdwadlvgtihyevvtsprgrit
    rtyrea
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xfcB (B:)
    mtpisqtpgllaeamvdlgaiehnvrvlrehaghaqlmavvkadgyghgatrvaqtalga
    gaaelgvatvdealalradgitapvlawlhppgidfgpalladvqvavsslrqldellha
    vrrtgrtatvtvkvdtglnrngvgpaqfpamltalrqamaedavrlrglmshmvyadkpd
    dsindvqaqrftaflaqareqgvrfevahlsnssatmarpdltfdlvrpgiavyglspvp
    algdmglvpamtvkcavalvksiragegvsyghtwiaprdtnlallpigyadgvfrslgg
    rlevlingrrcpgvgricmdqfmvdlgpgpldvaegdeailfgpgirgeptaqdwadlvg
    tihyevvtsprgritrtyreaenr
    

    Sequence, based on observed residues (ATOM records):
    >1xfcB (B:)
    laeamvdlgaiehnvrvlrehaghaqlmavvkadgyghgatrvaqtalgagaaelgvatv
    dealalradgitapvlawlhppgidfgpalladvqvavsslrqldellhavrrtgrtatv
    tvkvdtglnrngvgpaqfpamltalrqamaedavrlrglmshmvyadkpddsindvqaqr
    ftaflaqareqgvrfevahlsnssatmarpdltfdlvrpgiavyglspvpalgdmglvpa
    mtvkcavalvksirdtnlallpigyadgvfrslggrlevlingrrcpgvgricmdqfmvd
    lgpgpldvaegdeailfgpgirgeptaqdwadlvgtihyevvtsprgritrtyrea