PDB entry 1xf9

View 1xf9 on RCSB PDB site
Description: Structure of NBD1 from murine CFTR- F508S mutant
Class: transport protein
Keywords: Cystic Fibrosis, ABC transporters, nucleotide-binding domain, TRANSPORT PROTEIN
Deposited on 2004-09-14, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Mus musculus [TaxId:10090]
    Gene: CFTR, ABCC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26361 (Start-282)
      • engineered (120)
    Domains in SCOPe 2.07: d1xf9a_
  • Chain 'B':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Mus musculus [TaxId:10090]
    Gene: CFTR, ABCC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26361 (Start-282)
      • engineered (120)
    Domains in SCOPe 2.07: d1xf9b_
  • Chain 'C':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Mus musculus [TaxId:10090]
    Gene: CFTR, ABCC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26361 (0-282)
      • cloning artifact (0)
      • engineered (120)
    Domains in SCOPe 2.07: d1xf9c1, d1xf9c2
  • Chain 'D':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Mus musculus [TaxId:10090]
    Gene: CFTR, ABCC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26361 (Start-282)
      • engineered (120)
    Domains in SCOPe 2.07: d1xf9d_
  • Heterogens: MG, ATP, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xf9A (A:)
    sttgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninln
    iekgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikenii
    sgvsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdad
    lylldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfy
    gtfselqslrpdfssklmgydtfdqfteerrssiltetlrrfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xf9A (A:)
    tgiimenvtafweegfgelleksfshlclvgnpvlkninlniekgemlaitgstgsgkts
    llmlilgeleasegiikhsgrvsfcsqfswimpgtikeniisgvsydeyryksvvkacql
    qqditkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvfteeqv
    fescvcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfssklmg
    ydtfdqfteerrssiltetlrrfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xf9B (B:)
    sttgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninln
    iekgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikenii
    sgvsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdad
    lylldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfy
    gtfselqslrpdfssklmgydtfdqfteerrssiltetlrrfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xf9B (B:)
    ttgiimenvtafweegfgelleksfshlclvgnpvlkninlniekgemlaitgstgsgkt
    sllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniisgvsydeyryksvvkacq
    lqqditkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvfteeq
    vfescvcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfssklm
    gydtfdqfteerrssiltetlrrfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xf9C (C:)
    sttgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninln
    iekgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikenii
    sgvsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdad
    lylldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfy
    gtfselqslrpdfssklmgydtfdqfteerrssiltetlrrfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xf9C (C:)
    sttgiimenvtafweegfgellekfshlclvgnpvlkninlniekgemlaitgstgsgkt
    sllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniisgvsydeyryksvvkacq
    lqqditkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvfteeq
    vfescvcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfssklm
    gydtfdqfteerrssiltetlrrfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xf9D (D:)
    sttgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninln
    iekgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikenii
    sgvsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdad
    lylldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfy
    gtfselqslrpdfssklmgydtfdqfteerrssiltetlrrfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xf9D (D:)
    tgiimenvtafweegfgellshlclvgnpvlkninlniekgemlaitgstgsgktsllml
    ilgeleasegiikhsgrvsfcsqfswimpgtikeniisgvsydeyryksvvkacqlqqdi
    tkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvfteeqvfesc
    vcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfssklmgydtf
    dqfteerrssiltetlrrfs