PDB entry 1xf5

View 1xf5 on RCSB PDB site
Description: Complex HCV core-Fab 19D9D6-Protein L mutant (H74C, Y64W)in space group P21212
Deposited on 2004-09-14, released 2005-05-31
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.201
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoclonal antibody 19D9D6 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XF5 (0-219)
  • Chain 'B':
    Compound: Monoclonal antibody 19D9D6 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XF5 (0-217)
  • Chain 'C':
    Compound: Monoclonal antibody 19D9D6 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XF5 (0-219)
  • Chain 'D':
    Compound: Monoclonal antibody 19D9D6 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XF5 (0-217)
  • Chain 'L':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XF5 (Start-79)
  • Chain 'M':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XF5 (Start-79)
  • Chain 'P':
    Compound: capsid protein c
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: capsid protein c
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xf5A (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1xf5B (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1xf5C (C:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1xf5D (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1xf5L (L:)
    mnikfagkektpeepkeevtikvnlifadgkiqtaefkgtfeeataeayryadllakvng
    ewtadledggncmnikfagk
    

    Sequence, based on observed residues (ATOM records):
    >1xf5L (L:)
    ktpeepkeevtikvnlifadgkiqtaefkgtfeeataeayryadllakvngewtadledg
    gncmnikfagk
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1xf5M (M:)
    mnikfagkektpeepkeevtikvnlifadgkiqtaefkgtfeeataeayryadllakvng
    ewtadledggncmnikfagk
    

    Sequence, based on observed residues (ATOM records):
    >1xf5M (M:)
    epkeevtikvnlifadgkiqtaefkgtfeeataeayryadllakvngewtadledggncm
    nikfagk
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1xf5P (P:)
    stnpkpqrktkrntnrrpqdvkfpgggqivggvyllprrgprlg
    

    Sequence, based on observed residues (ATOM records):
    >1xf5P (P:)
    pgggqivggvyllprr
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1xf5Q (Q:)
    stnpkpqrktkrntnrrpqdvkfpgggqivggvyllprrgprlg
    

    Sequence, based on observed residues (ATOM records):
    >1xf5Q (Q:)
    qivggvyl