PDB entry 1xf4

View 1xf4 on RCSB PDB site
Description: Structure of ligand-free Fab DNA-1 in space group P321 solved from crystals with perfect hemihedral twinning
Class: immune system
Keywords: antibody, Fab, immunoglobulin, anti-DNA, anti-ssDNA, autoantibody, twinning, IMMUNE SYSTEM
Deposited on 2004-09-13, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28909 (0-End)
    Domains in SCOPe 2.07: d1xf4a1, d1xf4a2
  • Chain 'B':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28908 (4-End)
      • cloning artifact (0-3)
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28908 (4-End)
      • cloning artifact (0-3)
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28909 (0-End)
    Domains in SCOPe 2.07: d1xf4l1, d1xf4l2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xf4A (A:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xf4A (A:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1xf4L (L:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xf4L (L:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne