PDB entry 1xf1

View 1xf1 on RCSB PDB site
Description: Structure of C5a peptidase- a key virulence factor from Streptococcus
Deposited on 2004-09-13, released 2005-11-22
The last revision was dated 2008-05-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C5a peptidase
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: scpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15926 (0-925)
      • modified residue (113)
      • modified residue (121)
      • modified residue (153)
      • modified residue (247)
      • modified residue (327)
      • modified residue (407)
      • modified residue (416)
      • modified residue (430)
      • modified residue (444)
      • modified residue (479)
      • see remark 999 (542)
      • modified residue (574)
      • see remark 999 (591)
      • modified residue (596)
      • see remark 999 (688)
      • modified residue (863)
      • engineered (890)
      • modified residue (899)
      • modified residue (909)
  • Chain 'B':
    Compound: C5a peptidase
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: scpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15926 (0-925)
      • modified residue (113)
      • modified residue (121)
      • modified residue (153)
      • modified residue (247)
      • modified residue (327)
      • modified residue (407)
      • modified residue (416)
      • modified residue (430)
      • modified residue (444)
      • modified residue (479)
      • see remark 999 (542)
      • modified residue (574)
      • see remark 999 (591)
      • modified residue (596)
      • see remark 999 (688)
      • modified residue (863)
      • engineered (890)
      • modified residue (899)
      • modified residue (909)
  • Heterogens: ACT, CA, CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xf1A (A:)
    ndpsqvktlqekagkgagtvvavidagfdknheawrltdktkaryqskedlekakkehgi
    tygewvndkvayyhdyskdgktavdqehgthvsgilsgnapsetkepyrlegampeaqll
    lmrveivngladyarnyaqairdainlgakvinmsfgnaalayanlpdetkkafdyaksk
    gvsivtsagndssfggktrlpladhpdygvvgtpaaadstltvasyspdkqltetvrvkt
    adqqdkempvlstnrfepnkaydyayanrgtkeddfkdvkgkialiergdidfkdkiaka
    kkagavgvliydnqdkgfpielpnvdqmpaafisrkdglllkdnpqktitfnatpkvlpt
    asgtklsrfsswgltadgnikpdiaapgqdilssvannkyaklsgtsmsaplvagimgll
    qkqyetqypdmtpserldlakkvlmssatalydedekayfsprqqgagavdakkasaatm
    yvtdkdntsskvhlnnvsdkfevtvnvhnksdkpqelyyqatvqtdkvdgkhfalapkvl
    yetswqkitipansskqvtvpidasrfskdllaqmkngyflegfvrfkqdptkeelmsip
    yigfrgdfgnlsalekpiydskdgssyyheansdakdqldgdglqfyalknnftalttes
    npwtiikavkegveniediesseitetifagtfakqdddshyyihrhangkpyaaispng
    dgnrdyvqfqgtflrnaknlvaevldkegnvvwtsevteqvvknynndlastlgstrfek
    trwdgkdkdgkvvangtytyrvrytpissgakeqhtdfdvivdnttpevatsatfstedr
    rltlaskpktsqpvyreriaytymdedlptteyispnedgtftlpeeaetmegatvplkm
    sdftyvvedmagnitytpvtkllegh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1xf1B (B:)
    ndpsqvktlqekagkgagtvvavidagfdknheawrltdktkaryqskedlekakkehgi
    tygewvndkvayyhdyskdgktavdqehgthvsgilsgnapsetkepyrlegampeaqll
    lmrveivngladyarnyaqairdainlgakvinmsfgnaalayanlpdetkkafdyaksk
    gvsivtsagndssfggktrlpladhpdygvvgtpaaadstltvasyspdkqltetvrvkt
    adqqdkempvlstnrfepnkaydyayanrgtkeddfkdvkgkialiergdidfkdkiaka
    kkagavgvliydnqdkgfpielpnvdqmpaafisrkdglllkdnpqktitfnatpkvlpt
    asgtklsrfsswgltadgnikpdiaapgqdilssvannkyaklsgtsmsaplvagimgll
    qkqyetqypdmtpserldlakkvlmssatalydedekayfsprqqgagavdakkasaatm
    yvtdkdntsskvhlnnvsdkfevtvnvhnksdkpqelyyqatvqtdkvdgkhfalapkvl
    yetswqkitipansskqvtvpidasrfskdllaqmkngyflegfvrfkqdptkeelmsip
    yigfrgdfgnlsalekpiydskdgssyyheansdakdqldgdglqfyalknnftalttes
    npwtiikavkegveniediesseitetifagtfakqdddshyyihrhangkpyaaispng
    dgnrdyvqfqgtflrnaknlvaevldkegnvvwtsevteqvvknynndlastlgstrfek
    trwdgkdkdgkvvangtytyrvrytpissgakeqhtdfdvivdnttpevatsatfstedr
    rltlaskpktsqpvyreriaytymdedlptteyispnedgtftlpeeaetmegatvplkm
    sdftyvvedmagnitytpvtkllegh