PDB entry 1xf0

View 1xf0 on RCSB PDB site
Description: Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (AKR1C3) complexed with delta4-androstene-3,17-dione and NADP
Class: oxidoreductase
Keywords: alpha/beta barrel, beta-hairpin, OXIDOREDUCTASE
Deposited on 2004-09-13, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member C3
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C3, DDH1, PGFS, KIAA0119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xf0a_
  • Heterogens: ACT, NAP, ASD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xf0A (A:)
    mdskqqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeq
    vglairskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspm
    slkpgeelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgld
    rnlhyfnsdsfashpnypysdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xf0A (A:)
    qqcvklndghfmpvlgfgtyappeskalevtklaieagfrhidsahlynneeqvglairs
    kiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpgee
    lsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkykpv
    cnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcalakk
    hkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhyfn
    sdsfashpnypysdey