PDB entry 1xez

View 1xez on RCSB PDB site
Description: crystal structure of the vibrio cholerae cytolysin (hlya) pro-toxin with octylglucoside bound
Deposited on 2004-09-13, released 2005-06-14
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemolysin
    Species: Vibrio cholerae [TaxId:666]
    Gene: HlyA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BOG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xezA (A:)
    gamgsninepsgeaadiisqvadshaikyynaadwqaednalpslaelrdlvinqqkrvl
    vdfsqisdaegqaemqaqfrkaygvgfanqfivitehkgellftpfdrteeidpalleap
    rtaallgasgfaspapansetntlphvafyisvnraisdeectfnnswlwknekgsrpfc
    kdanisliyrvnlerslqygivgsatpdakivrisldddstgagihlndqlgyrqfgasy
    ttldayfrewstdaiaqdyrfvfnasnnkaqilktfpvdninekferkevsgfelgvtgg
    vevsgdgpkaklearasytqsrwltyntqdyriernaknaqavsftwnrqqyataeslln
    rstdalwvntypvdvnrisplsyasfvpkmdviykasatetgstdfiidssvnirpiyng
    aykhyyvvgahqsyhgfedtprrritksasftvdwdhpvftggrpvnlqlasfnnrciqv
    daqgrltanmcdsqqsaqsfiydqlgryvsasntklcldgaaldalqpcnqnltqrwewr
    kgtdeltnvysgeslghdkqtgelglyassndavslrtitaytdvfnaqesspilgytqg
    kmnqqrvgqdnrlyvragaaidalgsasdllvggnggslssvdlsgvksitatsgdfqyg
    gqqlvaltftyqdgrqqtvgskayvtnahedrfdlpdaakitqlkiwaddwlvkgvqfdl
    n
    

    Sequence, based on observed residues (ATOM records):
    >1xezA (A:)
    aikyynaadwqalpslaelrdlvinqqkrvlvdfsqisdaegqaemqaqfrkaygvgfan
    qfivitehkgellftpfdrteetntlphvafyisvnraisdeectfnnswlwknekgsrp
    fckdanisliyrvnlerslqygivgsatpdakivrisldddstgagihlndqlgyrqfga
    syttldayfrewstdaiaqdyrfvfnasnnkaqilktfpvdninekferkevsgfelgvt
    ggvevsgdgpkaklearasytqsrwltyntqdyriernaknaqavsftwnrqqyataesl
    lnrstdalwvntypvdvnrisplsyasfvpkmdviykasatetgstdfiidssvnirpiy
    ngaykhyyvvgahqsyhgfedtprrritksasftvdwdhpvftggrpvnlqlasfnnrci
    qvdaqgrltanmcdsqqsaqsfiydqlgryvsasntklcldgaaldalqpcnqnltqrwe
    wrkgtdeltnvysgeslghdkqtgelglyassndavslrtitaytdvfnaqesspilgyt
    qgkmnqqrvgqdnrlyvragaaidalgsasdllvggnggslssvdlsgvksitatsgdfq
    yggqqlvaltftyqdgrqqtvgskayvtnahedrfdlpdaakitqlkiwaddwlvkgvqf
    dln