PDB entry 1xey

View 1xey on RCSB PDB site
Description: Crystal structure of the complex of Escherichia coli GADA with glutarate at 2.05 A resolution
Class: lyase
Keywords: lyase, glutamate decarboxylase, complex with glutarate
Deposited on 2004-09-13, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.151
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate decarboxylase alpha
    Species: Escherichia coli [TaxId:562]
    Gene: GADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xeya_
  • Chain 'B':
    Compound: Glutamate decarboxylase alpha
    Species: Escherichia coli [TaxId:562]
    Gene: GADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xeyb_
  • Heterogens: ACT, PLP, GUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xeyA (A:)
    mdqklltdfrselldsrfgakaistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeyA (A:)
    klltdfrselldsrfgakaistiaeskrfplhemrddvafqiindelyldgnarqnlatf
    cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
    igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
    pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
    aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
    dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
    efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
    mcrrgfemdfaellledykaslkylsdh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xeyB (B:)
    mdqklltdfrselldsrfgakaistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeyB (B:)
    klltdfrselldsrfgakaistiaeskrfplhemrddvafqiindelyldgnarqnlatf
    cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
    igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
    pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
    aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
    dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
    efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
    mcrrgfemdfaellledykaslkylsdhp