PDB entry 1xew

View 1xew on RCSB PDB site
Description: Structural biochemistry of ATP-driven dimerization and DNA stimulated activation of SMC ATPases.
Class: cell cycle
Keywords: SMC, structural maintenance of chromosomes, ABC-ATPases, Condensin, Cohesin, CELL CYCLE
Deposited on 2004-09-13, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: SMC protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: SMC
    Database cross-references and differences (RAF-indexed):
    • GB CAD66602 (0-End)
    Domains in SCOPe 2.07: d1xew.1
  • Chain 'Y':
    Compound: SMC protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: SMC
    Database cross-references and differences (RAF-indexed):
    • GB CAD66602
    Domains in SCOPe 2.07: d1xew.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1xewX (X:)
    mpyieklelkgfksygnkkvvipfskgftaivgangsgksnigdailfvlgglsakamra
    srisdlifagskneppakyaevaiyfnnedrgfpidedevvirrrvypdgrssywlngrr
    atrseildiltaamispdgynivlqgditkfikmsplerrlliddisgiaeydskkekal
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xewX (X:)
    mpyieklelkgfksygnkkvvipfskgftaivgangsgksnigdailfvlgglsakakya
    evaiyfnnedrgfpidedevvirrrvypdgrssywlngrratrseildiltaamispdgy
    nivlqgditkfikmsplerrlliddis
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1xewY (Y:)
    ekekknvfmrtfeaisrnfseifaklspggsarlilenpedpfsggleieakpagkdvkr
    ieamsggekaltalafvfaiqkfkpapfylfdeidahlddanvkrvadlikesskesqfi
    vitlrdvmmanadkiigvsmrdgvskvvslslekamkileeirkkqgwehgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xewY (Y:)
    vfmrtfeaisrnfseifaklspggsarlilenpedpfsggleieakpagkdvkrieamsg
    gekaltalafvfaiqkfkpapfylfdeidahlddanvkrvadlikesskesqfivitlrd
    vmmanadkiigvsmgvskvvslslekamkileeirkkqgw