PDB entry 1xer

View 1xer on RCSB PDB site
Description: structure of ferredoxin
Class: electron transport
Keywords: electron transport, iron-sulfur, duplication
Deposited on 1996-08-28, released 1997-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Sulfolobus tokodaii str. 7 [TaxId:273063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55907 (0-102)
      • modified residue (28)
    Domains in SCOPe 2.07: d1xera_
  • Heterogens: ZN, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xerA (A:)
    gidpnyrtnrqvvgehsghkvygpveppkvlgihgtivgvdfdlciadgscinacpvnvf
    qwydtpghpasekkadpvneqacifcmacvnvcpvaaidvkpp