PDB entry 1xeq

View 1xeq on RCSB PDB site
Description: Crystal tructure of RNA binding domain of influenza B virus non-structural protein
Class: Viral protein
Keywords: Influenza B virus, RNA binding domain, non-structural protein, NS1B, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-09-11, released 2005-09-20
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nonstructural protein NS1
    Species: Influenza B virus
    Gene: 8
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xeqa1
  • Chain 'B':
    Compound: Nonstructural protein NS1
    Species: Influenza B virus
    Gene: 8
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xeqA (A:)
    madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrik
    thnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeqA (A:)
    gatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepenkrmsl
    eerkaigvkmmkvllfmdpsagiegfepy
    

  • Chain 'B':
    No sequence available.