PDB entry 1xeq

View 1xeq on RCSB PDB site
Description: Crystal tructure of RNA binding domain of influenza B virus non-structural protein
Class: Viral protein
Keywords: Influenza B virus, RNA binding domain, non-structural protein, NS1B, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Viral protein
Deposited on 2004-09-11, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nonstructural protein NS1
    Species: Influenza B virus [TaxId:107412]
    Gene: 8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xeqa1
  • Chain 'B':
    Compound: Nonstructural protein NS1
    Species: Influenza B virus [TaxId:107412]
    Gene: 8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xeqb_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xeqA (A:)
madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrik
thnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy

    Sequence, based on observed residues (ATOM records): (download) 
    >1xeqA (A:)
gatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepenkrmsl
eerkaigvkmmkvllfmdpsagiegfepy

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1xeqB (B:)
madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrik
thnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy

    Sequence, based on observed residues (ATOM records): (download) 
    >1xeqB (B:)
qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
nkrmsleerkaigvkmmkvllfmdp