PDB entry 1xep

View 1xep on RCSB PDB site
Description: Catechol in complex with T4 lysozyme L99A/M102Q
Class: hydrolase
Keywords: glycosidase, bacteriolytic enzyme, hydrolase
Deposited on 2004-09-10, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.188
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered (98)
      • engineered (101)
    Domains in SCOPe 2.07: d1xepa_
  • Heterogens: PO4, CAQ, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xepA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xepA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk