PDB entry 1xel

View 1xel on RCSB PDB site
Description: udp-galactose 4-epimerase from escherichia coli
Class: isomerase
Keywords: isomerase
Deposited on 1996-01-25, released 1997-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.137
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactose 4-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09147 (0-337)
      • conflict (130)
    Domains in SCOPe 2.07: d1xela_
  • Heterogens: NA, NAD, UPG, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xelA (A:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fsssatvygdnpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd