PDB entry 1xef

View 1xef on RCSB PDB site
Description: Crystal structure of the ATP/Mg2+ bound composite dimer of HlyB-NBD
Deposited on 2004-09-10, released 2005-06-07
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-hemolysin translocation ATP-binding protein hlyB
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08716 (0-240)
      • engineered (195)
  • Chain 'B':
    Compound: Alpha-hemolysin translocation ATP-binding protein hlyB
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08716 (0-240)
      • engineered (195)
  • Chain 'C':
    Compound: Alpha-hemolysin translocation ATP-binding protein hlyB
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08716 (0-240)
      • engineered (195)
  • Chain 'D':
    Compound: Alpha-hemolysin translocation ATP-binding protein hlyB
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08716 (0-240)
      • engineered (195)
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xefA (A:)
    ditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipengqv
    lidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklagahd
    fiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvimr
    nmhkickgrtviiiaarlstvknadriivmekgkiveqgkhkellsepeslysylyqlqs
    d
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1xefB (B:)
    ditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipengqv
    lidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklagahd
    fiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvimr
    nmhkickgrtviiiaarlstvknadriivmekgkiveqgkhkellsepeslysylyqlqs
    d
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1xefC (C:)
    ditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipengqv
    lidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklagahd
    fiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvimr
    nmhkickgrtviiiaarlstvknadriivmekgkiveqgkhkellsepeslysylyqlqs
    d
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1xefD (D:)
    ditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipengqv
    lidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklagahd
    fiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvimr
    nmhkickgrtviiiaarlstvknadriivmekgkiveqgkhkellsepeslysylyqlqs
    d