PDB entry 1xee

View 1xee on RCSB PDB site
Description: Solution structure of the Chemotaxis Inhibitory Protein of Staphylococcus aureus
Deposited on 2004-09-10, released 2005-09-27
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis-inhibiting protein CHIPS
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: CHP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xeeA (A:)
    nsglpttlgklderlrnylkkgtknsaqfekmviltenkgyytvylntplaedrknvell
    gkmyktyffkkgeskssyvingpgktneyay