PDB entry 1xec

View 1xec on RCSB PDB site
Description: dimeric bovine tissue-extracted decorin, crystal form 2
Deposited on 2004-09-09, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xeca_
  • Chain 'B':
    Domains in SCOP 1.71: d1xecb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xecA (A:)
    deasgigpeehfpevpeiepmgpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlq
    nnkiteikdgdfknlknlhtlilinnkiskispgafaplvklerlylsknqlkelpekmp
    ktlqelrvheneitkvrksvfnglnqmivvelgtnplkssgiengafqgmkklsyiriad
    tnittipqglppsltelhldgnkitkvdaaslkglnnlaklglsfnsisavdngslantp
    hlrelhlnnnklvkvpggladhkyiqvvylhnnnisaigsndfcppgyntkkasysgvsl
    fsnpvqyweiqpstfrcvyvraavqlgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xecA (A:)
    gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
    ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
    nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
    nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
    hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
    aavql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xecB (B:)
    deasgigpeehfpevpeiepmgpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlq
    nnkiteikdgdfknlknlhtlilinnkiskispgafaplvklerlylsknqlkelpekmp
    ktlqelrvheneitkvrksvfnglnqmivvelgtnplkssgiengafqgmkklsyiriad
    tnittipqglppsltelhldgnkitkvdaaslkglnnlaklglsfnsisavdngslantp
    hlrelhlnnnklvkvpggladhkyiqvvylhnnnisaigsndfcppgyntkkasysgvsl
    fsnpvqyweiqpstfrcvyvraavqlgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xecB (B:)
    gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
    ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
    nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
    nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
    hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
    aavql