PDB entry 1xea

View 1xea on RCSB PDB site
Description: Crystal structure of a Gfo/Idh/MocA family oxidoreductase from Vibrio cholerae
Class: Oxidoreductase
Keywords: Structural Genomics; Protein Structure Initiative; NYSGXRC; T1536; VCA1048; Gfo/Idh/MocA family oxidoreductase, PSI, New York Structural GenomiX Research Consortium
Deposited on 2004-09-09, released 2004-09-28
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.227
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, Gfo/Idh/MocA family
    Species: Vibrio cholerae
    Gene: VCA1048
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KKQ4 (3-End)
      • cloning artifact (1-2)
      • modified residue (6)
      • modified residue (67)
      • modified residue (191)
      • modified residue (214)
      • modified residue (244)
      • modified residue (261)
      • modified residue (270)
    Domains in SCOP 1.75: d1xeaa1, d1xeaa2
  • Chain 'B':
    Compound: Oxidoreductase, Gfo/Idh/MocA family
    Species: Vibrio cholerae
    Gene: VCA1048
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KKQ4 (3-End)
      • cloning artifact (1-2)
      • modified residue (6)
      • modified residue (67)
      • modified residue (191)
      • modified residue (214)
      • modified residue (244)
      • modified residue (261)
      • modified residue (270)
    Domains in SCOP 1.75: d1xeab1, d1xeab2
  • Chain 'C':
    Compound: Oxidoreductase, Gfo/Idh/MocA family
    Species: Vibrio cholerae
    Gene: VCA1048
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KKQ4 (3-End)
      • cloning artifact (1-2)
      • modified residue (6)
      • modified residue (67)
      • modified residue (191)
      • modified residue (214)
      • modified residue (244)
      • modified residue (261)
      • modified residue (270)
    Domains in SCOP 1.75: d1xeac1, d1xeac2
  • Chain 'D':
    Compound: Oxidoreductase, Gfo/Idh/MocA family
    Species: Vibrio cholerae
    Gene: VCA1048
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KKQ4 (3-End)
      • cloning artifact (1-2)
      • modified residue (6)
      • modified residue (67)
      • modified residue (191)
      • modified residue (214)
      • modified residue (244)
      • modified residue (261)
      • modified residue (270)
    Domains in SCOP 1.75: d1xead1, d1xead2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xeaA (A:)
    mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvl
    qygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvg
    fnrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrq
    cnlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsf
    tqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlae
    aicqqitqqvtkgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeaA (A:)
    slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
    ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
    nrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqc
    nlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsft
    qgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlaea
    icqqitqqvtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xeaB (B:)
    mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvl
    qygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvg
    fnrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrq
    cnlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsf
    tqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlae
    aicqqitqqvtkgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeaB (B:)
    slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
    ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
    nrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqc
    nlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsft
    qgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlaea
    icqqitqqvtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xeaC (C:)
    mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvl
    qygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvg
    fnrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrq
    cnlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsf
    tqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlae
    aicqqitqqvtkgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeaC (C:)
    slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
    ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
    nrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqc
    nlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsft
    qgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlaea
    icqqitqqvtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xeaD (D:)
    mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvl
    qygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvg
    fnrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrq
    cnlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsf
    tqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlae
    aicqqitqqvtkgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeaD (D:)
    slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
    ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
    nrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqc
    nlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsft
    qgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlaea
    icqqitqqvtk