PDB entry 1xea

View 1xea on RCSB PDB site
Description: Crystal structure of a Gfo/Idh/MocA family oxidoreductase from Vibrio cholerae
Deposited on 2004-09-09, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xeaA (A:)
    mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvl
    qygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvg
    fnrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrq
    cnlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsf
    tqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlae
    aicqqitqqvtkgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeaA (A:)
    slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
    ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
    nrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqc
    nlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsft
    qgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlaea
    icqqitqqvtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xeaB (B:)
    mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvl
    qygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvg
    fnrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrq
    cnlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsf
    tqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlae
    aicqqitqqvtkgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeaB (B:)
    slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
    ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
    nrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqc
    nlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsft
    qgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlaea
    icqqitqqvtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xeaC (C:)
    mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvl
    qygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvg
    fnrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrq
    cnlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsf
    tqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlae
    aicqqitqqvtkgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeaC (C:)
    slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
    ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
    nrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqc
    nlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsft
    qgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlaea
    icqqitqqvtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xeaD (D:)
    mslkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvl
    qygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvg
    fnrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrq
    cnlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsf
    tqgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlae
    aicqqitqqvtkgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xeaD (D:)
    slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
    ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
    nrrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqc
    nlddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsft
    qgkmwrdnqesrvalkdwtpmlaskgfdamvqdwlqvaaagklpthiiernlashqlaea
    icqqitqqvtk