PDB entry 1xe4

View 1xe4 on RCSB PDB site
Description: Crystal Structure of Weissella viridescens FemX (K36M) Mutant
Class: transferase
Keywords: Mutant, FemX, ligase
Deposited on 2004-09-09, released 2005-05-31
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FemX
    Species: Lactobacillus viridescens
    Gene: femx
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EY50 (0-334)
      • engineered (35)
    Domains in SCOP 1.73: d1xe4a1, d1xe4a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xe4A (A:)
    pvlnlndpqaveryeefmrqspygqvtqdlgwakvmnnwepvdvyleddqgaiiaamsml
    lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
    lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldlypsktkskikrpfrdg
    vevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafdadtmrifvaeregkll
    stgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtntdlydlggiesestdds
    lyvfkhvfvkdapreyigeidkvldpevyaelvkd