PDB entry 1xdz

View 1xdz on RCSB PDB site
Description: Crystal Structure of Gram_Positive Bacillus subtilis Glucose inhibited Division protein B (gidB), Structural genomics, MCSG
Class: transferase
Keywords: MCSG, Protein Structure Initiative, Structural Genomics, methyltransferase fold, GidB, PSI, Midwest Center for Structural Genomics
Deposited on 2004-09-08, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.203
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyltransferase gidB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: gidB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25813 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1xdza1, d1xdza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdzA (A:)
    nmnieeftsglaekgislsprqleqfelyydmlvewnekinltsitekkevylkhfydsi
    taafyvdfnqvnticdvgagagfpslpikicfphlhvtivdslnkritfleklsealqle
    nttfchdraetfgqrkdvresydivtaravarlsvlselclplvkknglfvalkaasaee
    elnagkkaittlggelenihsfklpieesdrnimvirkikntpkkyprkpgtpnkspieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdzA (A:)
    nmnieeftsglaekgislsprqleqfelyydmlvewnekinltsitekkevylkhfydsi
    taafyvdfnqvnticdvgagagfpslpikicfphlhvtivdslnkritfleklsealqle
    nttfchdraetfgqrkdvresydivtaravarlsvlselclplvkknglfvalkaaaeee
    lnagkkaittlggelenihsfklpieesdrnimvirkikntpkkyprkpgtpnkspie