PDB entry 1xdy

View 1xdy on RCSB PDB site
Description: Structural and Biochemical Identification of a Novel Bacterial Oxidoreductase, W-containing cofactor
Class: oxidoreductase
Keywords: Bioinformatics, sequence analysis, electron transfer, oxidoreductase, molybdoenzymes, molybdopterin
Deposited on 2004-09-08, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdya_
  • Chain 'B':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdyb_
  • Chain 'C':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdyc_
  • Chain 'D':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdyd_
  • Chain 'E':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdye_
  • Chain 'F':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdyf_
  • Chain 'G':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdyg_
  • Chain 'H':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdyh_
  • Chain 'I':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdyi_
  • Chain 'J':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdyj_
  • Heterogens: W, MTE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdyA (A:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyA (A:)
    kalefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgeva
    kpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafet
    iyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrliv
    pwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsg
    rqptllfngyadqvaslyrgldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xdyB (B:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyB (B:)
    lefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevakp
    ltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafetiy
    apeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivpw
    kygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgqr
    qptllfngyadqvaslyrgldl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xdyC (C:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyC (C:)
    kalefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgeva
    kpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafet
    iyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrliv
    pwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsg
    qrqptllfngyadqvaslyrgldl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xdyD (D:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyD (D:)
    kalefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgeva
    kpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafet
    iyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrliv
    pwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsg
    qrqptllfngyadqvaslyrgld
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xdyE (E:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyE (E:)
    alefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevak
    pltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafeti
    yapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivp
    wkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgq
    rqptllfngyadqvaslyrgld
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xdyF (F:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyF (F:)
    alefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevak
    pltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafeti
    yapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivp
    wkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgr
    qptllfngyadqvaslyrgldl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xdyG (G:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyG (G:)
    lefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevakp
    ltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafetiy
    apeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivpw
    kygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgrq
    ptllfngyadqvaslyrgldl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xdyH (H:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyH (H:)
    kalefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgeva
    kpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafet
    iyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrliv
    pwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsg
    qrqptllfngyadqvaslyrgldl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xdyI (I:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyI (I:)
    alefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevak
    pltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafeti
    yapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivp
    wkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgq
    rqptllfngyadqvaslyrgld
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1xdyJ (J:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdyJ (J:)
    alefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevak
    pltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafeti
    yapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivp
    wkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgq
    rqptllfngyadqvaslyrgld