PDB entry 1xdx

View 1xdx on RCSB PDB site
Description: Solution Structure of the Tctex1 Light Chain From Chlamydomonas Inner Dynein Arm I1
Deposited on 2004-09-08, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tctex1 Light Chain protein
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: AF039437
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tctex1 Light Chain protein
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: AF039437
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xdxA (A:)
    megvdpaveeaafvaddvsniikesidavlqnqqyseakvsqwtssclehcikrltalnk
    pfkyvvtciimqkngaglhtaascwwdsttdgsrtvrwenksmycictvfglai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1xdxB (B:)
    megvdpaveeaafvaddvsniikesidavlqnqqyseakvsqwtssclehcikrltalnk
    pfkyvvtciimqkngaglhtaascwwdsttdgsrtvrwenksmycictvfglai