PDB entry 1xdw

View 1xdw on RCSB PDB site
Description: NAD+-dependent (R)-2-Hydroxyglutarate Dehydrogenase from Acidaminococcus fermentans
Deposited on 2004-09-08, released 2005-03-08
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD+-dependent (R)-2-Hydroxyglutarate Dehydrogenase
    Species: Acidaminococcus fermentans [TaxId:905]
    Gene: hgh
    Database cross-references and differences (RAF-indexed):
    • PDB 1XDW (0-330)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xdwA (A:)
    mkvlcygvrdvelpifeacnkefgydikcvpdylntketaemaagfdavilrgncfankq
    nldiykklgvkyiltrtagtdhidkeyakelgfpmafvpryspnaiaelavtqammllrh
    tayttsrtakknfkvdafmfskevrnctvgvvglgrigrvaaqifhgmgatvigedvfei
    kgiedyctqvsldevleksdiitihapyikengavvtrdflkkmkdgailvncargqlvd
    teavieavesgklggygcdvldgeasvfgkdlegqklenplfeklvdlyprvlitphlgs
    ytdeavknmvevsyqnlkdlaetgdcpnkik