PDB entry 1xdt

View 1xdt on RCSB PDB site
Description: complex of diphtheria toxin and heparin-binding epidermal growth factor
Class: complex (toxin/growth factor)
Keywords: COMPLEX (TOXIN-GROWTH FACTOR), DIPHTHERIA TOXIN, RECEPTOR, HEPARIN-BINDING EPIDERMAL GROWTH FACTOR, EPIDERMAL GROWTH FACTOR, COMPLEX (TOXIN-GROWTH FACTOR) complex
Deposited on 1997-11-18, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.172
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: heparin-binding epidermal growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdtr_
  • Chain 'T':
    Compound: diphtheria toxin
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdtt1, d1xdtt2, d1xdtt3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1xdtR (R:)
    gshmrvtlsskpqalatpnkeehgkrkkkgkglgkkrdpclrkykdfcihgeckyvkelr
    apscichpgyhgerchgls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdtR (R:)
    pclrkykdfcihgeckyvkelrapscichpgyhgerchgls
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1xdtT (T:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacagnrvrrsvgsslscinldwdvirdktktkieslkehgpiknkmsespnktvse
    ekakqyleefhqtalehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekt
    taalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynf
    vesiinlfqvvhnsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdiki
    taentplpiagvllptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvg
    ngvhanlhvafhrsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdtT (T:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpnydddwkgfystdnkydaagys
    vdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikr
    fgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeymaqac
    agscinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtaleh
    pelselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgia
    dgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynr
    payspghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllpti
    pgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrssse
    kihsneissdsigvlgyqktvdhtkvnsklslffeiks