PDB entry 1xdq

View 1xdq on RCSB PDB site
Description: Structural and Biochemical Identification of a Novel Bacterial Oxidoreductase
Class: oxidoreductase
Keywords: Bioinformatics, sequence analysis, electron transfer, oxidoreductase, molybdoenzymes, molybdopterin
Deposited on 2004-09-07, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdqa_
  • Chain 'B':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdqb_
  • Chain 'C':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdqc_
  • Chain 'D':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdqd_
  • Chain 'E':
    Compound: Bacterial Sulfite Oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76342
      • see remark 999 (274)
    Domains in SCOPe 2.07: d1xdqe_
  • Heterogens: URE, MO, O, MTE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdqA (A:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdqA (A:)
    alefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevak
    pltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafeti
    yapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivp
    wkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgq
    rqptllfngyadqvaslyrgld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xdqB (B:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdqB (B:)
    alefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevak
    pltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafeti
    yapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivp
    wkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgq
    rqptllfngyadqvaslyrgldl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xdqC (C:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdqC (C:)
    kalefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgeva
    kpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafet
    iyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrliv
    pwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsg
    qrqptllfngyadqvaslyrgldl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xdqD (D:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdqD (D:)
    alefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevak
    pltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafeti
    yapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivp
    wkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgq
    rqptllfngyadqvaslyrgld
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xdqE (E:)
    dllswfkgndrppapagkalefskpaawqnnlpltpadkvsgynnfyefgldkadpaana
    gslktdpwtlkisgevakpltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkl
    lalaeptsnakyvafetiyapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgv
    ygkalppqngapvrlivpwkygfkgiksivsikltrerppttwnlaapdeygfyanvnpy
    vdhprwsqaterfigsggildvqrqptllfngyadqvaslyrgldlrenflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdqE (E:)
    alefskpaawqnnlpltpadkvsgynnfyefgldkadpaanagslktdpwtlkisgevak
    pltldhddltrrfpleeriyrmrcveawsmvvpwigfplhkllalaeptsnakyvafeti
    yapeqmpgqqdrfiggglkypyveglrldeamhpltlmtvgvygkalppqngapvrlivp
    wkygfkgiksivsikltrerppttwnlaapdeygfyanvnpyvdhprwsqaterfigsgq
    rqptllfngyadqvaslyrgld