PDB entry 1xdp

View 1xdp on RCSB PDB site
Description: Crystal Structure of the E.coli Polyphosphate Kinase in complex with AMPPNP
Class: transferase
Keywords: E.coli polyphosphate kinase, PPK, PPK complex with AMPPNP, AMPPNP, TRANSFERASE
Deposited on 2004-09-07, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24800000000000003
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyphosphate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: ppk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xdpa1, d1xdpa2, d1xdpa3, d1xdpa4
  • Chain 'B':
    Compound: Polyphosphate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: ppk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xdpb1, d1xdpb2, d1xdpb3, d1xdpb4
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xdpA (A:)
    gqeklyiekelswlsfnervlqeaadksnpliermrflgiysnnldefykvrfaelkrri
    iiseeqgsnshsrhllgkiqsrvlkadqefdglynelllemarnqiflinerqlsvnqqn
    wlrhyfkqylrqhitpilinpdtdlvqflkddytylaveiirgdtiryalleipsdkvpr
    fvnlppeaprrrkpmilldnilryclddifkgffdydalnaysmkmtrdaeydlvhemea
    slmelmssslkqrltaepvrfvyqrdmpnalvevlrekltisrydsivpggryhnfkdfi
    nfpnvgkanlvnkplprlrhiwfdkaqfrngfdairerdvllyypyhtfehvlellrqas
    fdpsvlaikiniyrvakdsriidsmihaahngkkvtvvvelqarfdeeanihwakrltea
    gvhvifsapglkihaklflisrkengevvryahigtgnfnektarlytdyslltadarit
    nevrrvfnfienpyrpvtfdylmvspqnsrrllyemvdreianaqqglpsgitlklnnlv
    dkglvdrlyaasssgvpvnllvrgmcslipnlegisdniraisivdrylehdrvyifeng
    gdkkvylssadwmtrnidyrievatplldprlkqrvldiidilfsdtvkaryidkelsnr
    yvprgnrrkvraqlaiydyiksleqpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xdpB (B:)
    gqeklyiekelswlsfnervlqeaadksnpliermrflgiysnnldefykvrfaelkrri
    iiseeqgsnshsrhllgkiqsrvlkadqefdglynelllemarnqiflinerqlsvnqqn
    wlrhyfkqylrqhitpilinpdtdlvqflkddytylaveiirgdtiryalleipsdkvpr
    fvnlppeaprrrkpmilldnilryclddifkgffdydalnaysmkmtrdaeydlvhemea
    slmelmssslkqrltaepvrfvyqrdmpnalvevlrekltisrydsivpggryhnfkdfi
    nfpnvgkanlvnkplprlrhiwfdkaqfrngfdairerdvllyypyhtfehvlellrqas
    fdpsvlaikiniyrvakdsriidsmihaahngkkvtvvvelqarfdeeanihwakrltea
    gvhvifsapglkihaklflisrkengevvryahigtgnfnektarlytdyslltadarit
    nevrrvfnfienpyrpvtfdylmvspqnsrrllyemvdreianaqqglpsgitlklnnlv
    dkglvdrlyaasssgvpvnllvrgmcslipnlegisdniraisivdrylehdrvyifeng
    gdkkvylssadwmtrnidyrievatplldprlkqrvldiidilfsdtvkaryidkelsnr
    yvprgnrrkvraqlaiydyiksleqpe