PDB entry 1xdo

View 1xdo on RCSB PDB site
Description: Crystal Structure of Escherichia coli Polyphosphate Kinase
Class: transferase
Keywords: polyphosphate kinase, PPK, E.coli polyphosphate kinase, TRANSFERASE
Deposited on 2004-09-07, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.255
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyphosphate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: ppk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdoa1, d1xdoa2, d1xdoa3, d1xdoa4
  • Chain 'B':
    Compound: Polyphosphate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: ppk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdob1, d1xdob2, d1xdob3, d1xdob4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xdoA (A:)
    gqeklyiekelswlsfnervlqeaadksnpliermrflgiysnnldefykvrfaelkrri
    iiseeqgsnshsrhllgkiqsrvlkadqefdglynelllemarnqiflinerqlsvnqqn
    wlrhyfkqylrqhitpilinpdtdlvqflkddytylaveiirgdtiryalleipsdkvpr
    fvnlppeaprrrkpmilldnilryclddifkgffdydalnaysmkmtrdaeydlvhemea
    slmelmssslkqrltaepvrfvyqrdmpnalvevlrekltisrydsivpggryhnfkdfi
    nfpnvgkanlvnkplprlrhiwfdkaqfrngfdairerdvllyypyhtfehvlellrqas
    fdpsvlaikiniyrvakdsriidsmihaahngkkvtvvvelqarfdeeanihwakrltea
    gvhvifsapglkihaklflisrkengevvryahigtgnfnektarlytdyslltadarit
    nevrrvfnfienpyrpvtfdylmvspqnsrrllyemvdreianaqqglpsgitlklnnlv
    dkglvdrlyaasssgvpvnllvrgmcslipnlegisdniraisivdrylehdrvyifeng
    gdkkvylssadwmtrnidyrievatplldprlkqrvldiidilfsdtvkaryidkelsnr
    yvprgnrrkvraqlaiydyiksleqpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xdoB (B:)
    gqeklyiekelswlsfnervlqeaadksnpliermrflgiysnnldefykvrfaelkrri
    iiseeqgsnshsrhllgkiqsrvlkadqefdglynelllemarnqiflinerqlsvnqqn
    wlrhyfkqylrqhitpilinpdtdlvqflkddytylaveiirgdtiryalleipsdkvpr
    fvnlppeaprrrkpmilldnilryclddifkgffdydalnaysmkmtrdaeydlvhemea
    slmelmssslkqrltaepvrfvyqrdmpnalvevlrekltisrydsivpggryhnfkdfi
    nfpnvgkanlvnkplprlrhiwfdkaqfrngfdairerdvllyypyhtfehvlellrqas
    fdpsvlaikiniyrvakdsriidsmihaahngkkvtvvvelqarfdeeanihwakrltea
    gvhvifsapglkihaklflisrkengevvryahigtgnfnektarlytdyslltadarit
    nevrrvfnfienpyrpvtfdylmvspqnsrrllyemvdreianaqqglpsgitlklnnlv
    dkglvdrlyaasssgvpvnllvrgmcslipnlegisdniraisivdrylehdrvyifeng
    gdkkvylssadwmtrnidyrievatplldprlkqrvldiidilfsdtvkaryidkelsnr
    yvprgnrrkvraqlaiydyiksleqpe