PDB entry 1xdn

View 1xdn on RCSB PDB site
Description: High resolution crystal structure of an editosome enzyme from trypanosoma brucei: RNA editing ligase 1
Deposited on 2004-09-07, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.129
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xdna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdnA (A:)
    ghmdqsdfspyieidlpsesriqslhksglaaqewvacekvhgtnfgiylinqgdhevvr
    fakrsgimdpnenffgyhilideftaqirilndllkqkyglsrvgrlvlngelfgakykh
    plvpksekwctlpngkkfpiagvqiqrepfpqyspelhffafdikysvsgaeedfvllgy
    defvefsskvpnllyaralvrgtldeclafdvenfmtplpallglgnyplegnlaegvvi
    rhvrrgdpavekhnvstiiklrcssfmelkhpgkqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdnA (A:)
    qsdfspyieidlpsesriqslhksglaaqewvacekvhgtnfgiylinqgdhevvrfakr
    sgimdpnenffgyhilideftaqirilndllkqkyglsrvgrlvlngelfgakykhplvp
    ksekwctlpngkkfpiagvqiqrepfpqyspelhffafdikysvsgaeedfvllgydefv
    efsskvpnllyaralvrgtldeclafdvenfmtplpallglgnyplegnlaegvvirhvr
    rgdpavekhnvstiiklrcssfmel