PDB entry 1xdn

View 1xdn on RCSB PDB site
Description: High resolution crystal structure of an editosome enzyme from trypanosoma brucei: RNA editing ligase 1
Class: ligase
Keywords: RNA editing, Ligase, Trypanosoma brucei,
Deposited on 2004-09-07, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.129
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA editing ligase MP52
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: MP52
    Database cross-references and differences (RAF-indexed):
    • GB AAG27062
      • modified residue (67)
      • modified residue (215)
      • modified residue (266)
    Domains in SCOPe 2.07: d1xdna_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdnA (A:)
    ghmdqsdfspyieidlpsesriqslhksglaaqewvacekvhgtnfgiylinqgdhevvr
    fakrsgimdpnenffgyhilideftaqirilndllkqkyglsrvgrlvlngelfgakykh
    plvpksekwctlpngkkfpiagvqiqrepfpqyspelhffafdikysvsgaeedfvllgy
    defvefsskvpnllyaralvrgtldeclafdvenfmtplpallglgnyplegnlaegvvi
    rhvrrgdpavekhnvstiiklrcssfmelkhpgkqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdnA (A:)
    qsdfspyieidlpsesriqslhksglaaqewvacekvhgtnfgiylinqgdhevvrfakr
    sgimdpnenffgyhilideftaqirilndllkqkyglsrvgrlvlngelfgakykhplvp
    ksekwctlpngkkfpiagvqiqrepfpqyspelhffafdikysvsgaeedfvllgydefv
    efsskvpnllyaralvrgtldeclafdvenfmtplpallglgnyplegnlaegvvirhvr
    rgdpavekhnvstiiklrcssfmel