PDB entry 1xdk

View 1xdk on RCSB PDB site
Description: Crystal Structure of the RARbeta/RXRalpha Ligand Binding Domain Heterodimer in Complex with 9-cis Retinoic Acid and a Fragment of the TRAP220 Coactivator
Class: hormone/growth factor receptor
Keywords: Nuclear Receptor, Coactivator, Ligand, HORMONE/GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2004-09-07, released 2004-11-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.253
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Mus musculus [TaxId:10090]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xdka_
  • Chain 'B':
    Compound: Retinoic acid receptor, beta
    Species: Mus musculus [TaxId:10090]
    Gene: Rarb, Nr1b2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xdkb_
  • Chain 'C':
    Compound: Thyroid Receptor Associated Protein 220
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Thyroid Receptor Associated Protein 220
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Mus musculus [TaxId:10090]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xdke_
  • Chain 'F':
    Compound: Retinoic acid receptor, beta
    Species: Mus musculus [TaxId:10090]
    Gene: Rarb, Nr1b2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xdkf_
  • Chain 'G':
    Compound: Thyroid Receptor Associated Protein 220
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Thyroid Receptor Associated Protein 220
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdkA (A:)
    sanedmpvekileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
    riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
    ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
    khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdkA (A:)
    anedmpvekileaelaveppndpvtnicqaadkqlftlvewakriphfselplddqvill
    ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
    mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
    lpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xdkB (B:)
    mskesvrndrnkkkkepskqectesyemtaelddltekirkahqetfpslcqlgkyttns
    sadhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililr
    ictrytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsai
    clicgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakga
    ervitlkmeipgsmppliqemlenseghepltpsssgniaehspsvspssvensgvsqsp
    llq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdkB (B:)
    aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
    fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
    fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
    yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe
    pltps
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xdkE (E:)
    sanedmpvekileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
    riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
    ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
    khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdkE (E:)
    anedmpvekileaelaveppndpvtnicqaadkqlftlvewakriphfselplddqvill
    ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
    mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
    lpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xdkF (F:)
    mskesvrndrnkkkkepskqectesyemtaelddltekirkahqetfpslcqlgkyttns
    sadhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililr
    ictrytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsai
    clicgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakga
    ervitlkmeipgsmppliqemlenseghepltpsssgniaehspsvspssvensgvsqsp
    llq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdkF (F:)
    aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
    fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
    fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
    yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe
    pltps
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.