PDB entry 1xdk

View 1xdk on RCSB PDB site
Description: crystal structure of the rarbeta/rxralpha ligand binding domain heterodimer in complex with 9-cis retinoic acid and a fragment of the trap220 coactivator
Deposited on 2004-09-07, released 2004-11-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.253
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xdka_
  • Chain 'B':
    Domains in SCOP 1.71: d1xdkb_
  • Chain 'E':
    Domains in SCOP 1.71: d1xdke_
  • Chain 'F':
    Domains in SCOP 1.71: d1xdkf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdkA (A:)
    sanedmpvekileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
    riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
    ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
    khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdkA (A:)
    anedmpvekileaelaveppndpvtnicqaadkqlftlvewakriphfselplddqvill
    ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
    mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
    lpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xdkB (B:)
    mskesvrndrnkkkkepskqectesyemtaelddltekirkahqetfpslcqlgkyttns
    sadhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililr
    ictrytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsai
    clicgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakga
    ervitlkmeipgsmppliqemlenseghepltpsssgniaehspsvspssvensgvsqsp
    llq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdkB (B:)
    aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
    fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
    fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
    yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe
    pltps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xdkE (E:)
    sanedmpvekileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
    riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
    ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
    khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdkE (E:)
    anedmpvekileaelaveppndpvtnicqaadkqlftlvewakriphfselplddqvill
    ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
    mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
    lpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xdkF (F:)
    mskesvrndrnkkkkepskqectesyemtaelddltekirkahqetfpslcqlgkyttns
    sadhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililr
    ictrytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsai
    clicgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakga
    ervitlkmeipgsmppliqemlenseghepltpsssgniaehspsvspssvensgvsqsp
    llq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdkF (F:)
    aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
    fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
    fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
    yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe
    pltps