PDB entry 1xdj

View 1xdj on RCSB PDB site
Description: crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine
Deposited on 2004-09-06, released 2005-03-01
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: metE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X112 (33-End)
      • expression tag (32)
      • modified residue (69)
      • modified residue (74)
      • modified residue (76)
      • modified residue (104)
      • modified residue (124)
      • modified residue (133)
      • modified residue (201)
      • modified residue (375)
      • modified residue (452)
      • modified residue (499)
      • modified residue (541)
      • modified residue (560)
      • modified residue (568)
      • modified residue (650)
      • modified residue (713)
      • modified residue (752)
      • modified residue (759)
  • Chain 'B':
    Compound: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: metE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X112 (33-End)
      • expression tag (31-32)
      • modified residue (69)
      • modified residue (74)
      • modified residue (76)
      • modified residue (104)
      • modified residue (124)
      • modified residue (133)
      • modified residue (201)
      • modified residue (375)
      • modified residue (452)
      • modified residue (499)
      • modified residue (541)
      • modified residue (560)
      • modified residue (568)
      • modified residue (650)
      • modified residue (713)
      • modified residue (752)
      • modified residue (759)
  • Heterogens: SO4, ZN, HCS, MRY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xdjA (A:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftkayafgfpkigekrefkkaledfwkgk
    iteeqfeeemnklrmymvenyrknvdvipsnelsyydfvldtavmvgavperfgeyrgls
    tyfdmarggkalemtkffntnyhylvpeieteefyllenkpledylffkskgietapwvi
    gpftflylskrngewirrpnqmeklleslvsvykevfeklvengckeilvnepafvcdle
    kahwdlilnvyrelsefpltvftyydsvsdyeacvslpvkrlhfdfvsneenlknlekhg
    fpedkklvagvingrqpwkvdlrkvaslveklgasaisnscplfhlpvtlelennlpggl
    keklafakekleelkmlkdflegktfdlpnvsfedfavdlqavervrnlpedsfrrekey
    terdriqrerlnlplfptttigsfpqtpevrkmrskyrkgeiskeeyeafikeqikkaie
    lqeeigldvlvhgefertdmveffaeklngiattqngwvlsygsrcyrppiiygtvtrpe
    pmtlkeityaqsltekpvkgmltgpvtimswsyyredipereiayqialaineevkdlee
    agikivqidepafrekapikkskwpeyfewainafnlaanarpetqihahmcysdfneii
    eyihqlefdvisieasrskgeiisafenfkgwikqigvgvwdihspavpsinemreiver
    vlrvlpkeliwinpdcglktrnwdevipslrnmvalakemrekfes
    

    Sequence, based on observed residues (ATOM records):
    >1xdjA (A:)
    tkayafgfpkigekrefkkaledfwkgkiteeqfeeemnklrmymvenyrknvdvipsne
    lsyydfvldtavmvgavperfgeyrglstyfdmarggkalemtkffntnyhylvpeiete
    efyllenkpledylffkskgietapwvigpftflylskrngewirrpnqmeklleslvsv
    ykevfeklvengckeilvnepafvcdlekahwdlilnvyrelsefpltvftyydsvsdye
    acvslpvkrlhfdfvsneenlknlekhgfpedkklvagvingrqpwkvdlrkvaslvekl
    gasaisnscplfhlpvtlelennlpgglkeklafakekleelkmlkdflefedfavdlqa
    vervrnpedsfrrekeyterdriqrerlnlplfptttigsfpqtpevrkmrskyrkgeis
    keeyeafikeqikkaielqeeigldvlvhgefertdmveffaeklngiattqngwvlsyg
    srcyrppiiygtvtrpepmtlkeityaqsltekpvkgmltgpvtimswsyyrediperei
    ayqialaineevkdleeagikivqidepafrekapikkskwpeyfewainafnlaanarp
    etqihahmcysdfneiieyihqlefdvisieasrskgeiisafenfkgwikqigvgvwdi
    hspavpsinemreivervlrvlpkeliwinpdcglktrnwdevipslrnmvalakemrek
    fe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xdjB (B:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftkayafgfpkigekrefkkaledfwkgk
    iteeqfeeemnklrmymvenyrknvdvipsnelsyydfvldtavmvgavperfgeyrgls
    tyfdmarggkalemtkffntnyhylvpeieteefyllenkpledylffkskgietapwvi
    gpftflylskrngewirrpnqmeklleslvsvykevfeklvengckeilvnepafvcdle
    kahwdlilnvyrelsefpltvftyydsvsdyeacvslpvkrlhfdfvsneenlknlekhg
    fpedkklvagvingrqpwkvdlrkvaslveklgasaisnscplfhlpvtlelennlpggl
    keklafakekleelkmlkdflegktfdlpnvsfedfavdlqavervrnlpedsfrrekey
    terdriqrerlnlplfptttigsfpqtpevrkmrskyrkgeiskeeyeafikeqikkaie
    lqeeigldvlvhgefertdmveffaeklngiattqngwvlsygsrcyrppiiygtvtrpe
    pmtlkeityaqsltekpvkgmltgpvtimswsyyredipereiayqialaineevkdlee
    agikivqidepafrekapikkskwpeyfewainafnlaanarpetqihahmcysdfneii
    eyihqlefdvisieasrskgeiisafenfkgwikqigvgvwdihspavpsinemreiver
    vlrvlpkeliwinpdcglktrnwdevipslrnmvalakemrekfes
    

    Sequence, based on observed residues (ATOM records):
    >1xdjB (B:)
    ftkayafgfpkigekrefkkaledfwkgkiteeqfeeemnklrmymvenyrknvdvipsn
    elsyydfvldtavmvgavperfgeyrglstyfdmarggkalemtkffntnyhylvpeiet
    eefyllenkpledylffkskgietapwvigpftflylskrngewirrpnqmeklleslvs
    vykevfeklvengckeilvnepafvcdlekahwdlilnvyrelsefpltvftyydsvsdy
    eacvslpvkrlhfdfvsneenlknlekhgfpedkklvagvingrqpwkvdlrkvaslvek
    lgasaisnscplfhlpvtlelennlpgglkeklafakekleelkmlkdflegktfavdlq
    avervrnpedsfrrekeyterdriqrerlnlplfptttigsfpqtpevrkmiskeeyeaf
    ikeqikkaielqeeigldvlvhgefertdmveffaeklngiattqngwvlsygsrcyrpp
    iiygtvtrpepmtlkeityaqsltekpvkgmltgpvtimswsyyredipereiayqiala
    ineevkdleeagikivqidepafrekapikkskwpeyfewainafnlaanarpetqihah
    mcysdfneiieyihqlefdvisieasrskgeiisafenfkgwikqigvgvwdihspavps
    inemreivervlrvlpkeliwinpdcglktrnwdevipslrnmvalakemre