PDB entry 1xdi

View 1xdi on RCSB PDB site
Description: Crystal structure of LpdA (Rv3303c) from Mycobacterium tuberculosis
Class: unknown function
Keywords: Mycobacterium tuberculosis, reductase, FAD, NAD, NADP, UNKNOWN FUNCTION
Deposited on 2004-09-06, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.194
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rv3303c-lpdA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv3303c - lpdA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdia1, d1xdia2
  • Chain 'B':
    Compound: Rv3303c-lpdA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv3303c - lpdA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdib1, d1xdib2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdiA (A:)
    mvtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastgl
    rtelrraphlgfhidfddakislpqiharvktlaaaqsaditaqllsmgvqviagrgeli
    dstpglarhrikataadgstseheadvvlvatgasprilpsaqpdgeriltwrqlydlda
    lpdhlivvgsgvtgaefvdaytelgvpvtvvasqdhvlpyedadaalvleesfaergvrl
    fknaraasvtrtgagvlvtmtdgrtvegshalmtigsvpntsglglervgiqlgrgnylt
    vdrvsrtlatgiyaagdctgllplasvaamqgriamyhalgegvspirlrtvaatvftrp
    eiaavgvpqsvidagsvaartimlplrtnarakmsemrhgfvkifcrrstgvviggvvva
    piaselilpiavavqnritvnelaqtlavypslsgsiteaarrlmahddldctaaqdaae
    qlalvphhlptsnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdiA (A:)
    vtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastglr
    telrraphlgfhkislpqiharvktlaaaqsaditaqllsmgvqviagrgelidstpgla
    rhrikataadgstseheadvvlvatgasprilpsaqpdgeriltwrqlydldalpdhliv
    vgsgvtgaefvdaytelgvpvtvvasqdhvlpyedadaalvleesfaergvrlfknaraa
    svtrtgagvlvtmtdgrtvegshalmtigsvpntsglglervgiqlgrgnyltvdrvsrt
    latgiyaagdctgllplasvaamqgriamyhalgegvspirlrtvaatvftrpeiaavgv
    pqsvidagsvaartimlplrtnarakmsemrhgfvkifcrrstgvviggvvvapiaseli
    lpiavavqnritvnelaqtlavypslsgsiteaarrlma
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xdiB (B:)
    mvtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastgl
    rtelrraphlgfhidfddakislpqiharvktlaaaqsaditaqllsmgvqviagrgeli
    dstpglarhrikataadgstseheadvvlvatgasprilpsaqpdgeriltwrqlydlda
    lpdhlivvgsgvtgaefvdaytelgvpvtvvasqdhvlpyedadaalvleesfaergvrl
    fknaraasvtrtgagvlvtmtdgrtvegshalmtigsvpntsglglervgiqlgrgnylt
    vdrvsrtlatgiyaagdctgllplasvaamqgriamyhalgegvspirlrtvaatvftrp
    eiaavgvpqsvidagsvaartimlplrtnarakmsemrhgfvkifcrrstgvviggvvva
    piaselilpiavavqnritvnelaqtlavypslsgsiteaarrlmahddldctaaqdaae
    qlalvphhlptsnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdiB (B:)
    vtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastglr
    telrraphlgfhkislpqiharvktlaaaqsaditaqllsmgvqviagrgelidstpgla
    rhrikataadgstseheadvvlvatgasprilpsaqpdgeriltwrqlydldalpdhliv
    vgsgvtgaefvdaytelgvpvtvvasqdhvlpyedadaalvleesfaergvrlfknaraa
    svtrtgagvlvtmtdgrtvegshalmtigsvpntsglglervgiqlgrgnyltvdrvsrt
    latgiyaagdctgllplasvaamqgriamyhalgegvspirlrtvaatvftrpeiaavgv
    pqsvidagsvaartimlplrtnarakmsemrhgfvkifcrrstgvviggvvvapiaseli
    lpiavavqnritvnelaqtlavypslsgsiteaarrlma