PDB entry 1xdc

View 1xdc on RCSB PDB site
Description: Hydrogen Bonding in Human Manganese Superoxide Dismutase containing 3-Fluorotyrosine
Class: oxidoreductase
Keywords: MnSOD, Manganese Superoxide Dismutase, 3-Fluorotyrosine, OXIDOREDUCTASE
Deposited on 2004-09-05, released 2005-03-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.212
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • modified residue (8)
      • modified residue (10)
      • modified residue (33)
      • modified residue (44)
      • modified residue (164-165)
      • modified residue (168)
      • modified residue (175)
      • modified residue (192)
    Domains in SCOPe 2.02: d1xdca1, d1xdca2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • modified residue (8)
      • modified residue (10)
      • modified residue (33)
      • modified residue (44)
      • modified residue (164-165)
      • modified residue (168)
      • modified residue (175)
      • modified residue (192)
    Domains in SCOPe 2.02: d1xdcb1, d1xdcb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xdcA (A:)
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
wnvinwenvterymackk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xdcB (B:)
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
wnvinwenvterymackk