PDB entry 1xd7

View 1xd7 on RCSB PDB site
Description: Crystal structure of a putative DNA binding protein
Class: DNA binding protein
Keywords: Structural Genomics, Protein Structure Initiative, winged helix DNA binding, hypothetical protein, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, DNA BINDING PROTEIN
Deposited on 2004-09-04, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ywnA
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: ywnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xd7a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xd7A (A:)
mslinsrlavaihilslismdektsseiiadsvntnpvvvrrmisllkkadiltsragvp
gaslkkdpadisllevyravqkqeelfavhenpnpkcpvgkkiqnaldetfesvqramen
elaskslkdvmnhlfeggshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1xd7A (A:)
srlavaihilslismdektsseiiadsvntnpvvvrrmisllkkadiltsragvpgaslk
kdpadisllevyravqknpkcpvgkkiqnaldetfesvqramenelaskslkdvmn