PDB entry 1xd6

View 1xd6 on RCSB PDB site
Description: Crystal structures of novel monomeric monocot mannose-binding lectins from Gastrodia elata
Class: antifungal protein
Keywords: monocot mannose-binding lectin, monomer, homogeneous beta-sheet, antifungal protein
Deposited on 2004-09-04, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gastrodianin-4
    Species: Gastrodia elata [TaxId:91201]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xd6a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xd6A (A:)
    sdrlnagkslgaggslaegpylfimqndcnlvlydnnravwasgtngkasncilkmqrdg
    nlviysgsramwasntnrqdgnyylilqrdrnvviydnsnnaiwasgtnvgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xd6A (A:)
    sdrlnagkslgaggslaegpylfimqndcnlvlydnnravwasgtngkasncilkmqrdg
    nlviysgsramwasntnrqdgnyylilqrdrnvviydnsnnaiwasgtnv