PDB entry 1xd1

View 1xd1 on RCSB PDB site
Description: acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Deposited on 2004-09-03, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xd1A (A:)
    eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
    eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
    pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl