PDB entry 1xcv

View 1xcv on RCSB PDB site
Description: Crystal Structure Of (H79AC102D)Dtxr complexed with Nickel(II)
Class: DNA binding protein
Keywords: helix-turn-helix, DNA BINDING PROTEIN
Deposited on 2004-09-03, released 2005-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.279
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Diphtheria toxin repressor mutant
  Species: Corynebacterium diphtheriae [TaxId:1717]
  Gene: DTXR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33120 (0-138)
    • engineered (78)
    • engineered (101)
  Domains in SCOPe 2.08: d1xcva1, d1xcva2
• Heterogens: NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xcvA (A:)
  mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
  slqmtptgrtlatavmrkarlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl
  kdvsrspfgnpipgldelg