PDB entry 1xcr

View 1xcr on RCSB PDB site
Description: Crystal Structure of Longer Splice Variant of PTD012 from Homo sapiens reveals a novel Zinc-containing fold
Class: metal binding protein
Keywords: Structural Genomics, Zinc-Containing Fold, Splice Variant, Acetate Buffer, METAL BINDING PROTEIN
Deposited on 2004-09-03, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PTD012
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp564H1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xcra1
  • Chain 'B':
    Compound: hypothetical protein PTD012
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp564H1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xcrb_
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xcrA (A:)
    gsacaefsfhvpsleelagvmqkglkdnfadvqvsvvdcpdltkepftfpvkgicgktri
    aevggvpyllplvnqkkvydlnkiakeiklpgafilgagagpfqtlgfnsefmpviqtes
    ehkppvngsyfahvnpadggcllekysekchdfqcallanlfasegqpgkvievkakrrt
    gplnfvtcmretlekhygnkpigmggtfiiqkgkvkshimpaefsscplnsdeevnkwlh
    fyemkaplvclpvfvsrdpgfdlrlehthffsrhgegghyhydttpdiveylgyflpaef
    lyridqpkethsigrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcrA (A:)
    caefsfhvpsleelagvmqkglkdnfadvqvsvvdcpdltkepftfpvkgicgktriaev
    ggvpyllplvnqkkvydlnkiakeiklpgafilgagagpfqtlgfnsefmpviqtesehk
    ppvngsyfahvnpadggcllekysekchdfqcallanlfasegqpgkvievkakrrtgpl
    nfvtcmretlekhygnkpigmggtfiiqkgkvkshimpaefsscplnsdeevnkwlhfye
    mkaplvclpvfvsrdpgfdlrlehthffsrhgegghyhydttpdiveylgyflpaeflyr
    idqpkethsigrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xcrB (B:)
    gsacaefsfhvpsleelagvmqkglkdnfadvqvsvvdcpdltkepftfpvkgicgktri
    aevggvpyllplvnqkkvydlnkiakeiklpgafilgagagpfqtlgfnsefmpviqtes
    ehkppvngsyfahvnpadggcllekysekchdfqcallanlfasegqpgkvievkakrrt
    gplnfvtcmretlekhygnkpigmggtfiiqkgkvkshimpaefsscplnsdeevnkwlh
    fyemkaplvclpvfvsrdpgfdlrlehthffsrhgegghyhydttpdiveylgyflpaef
    lyridqpkethsigrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcrB (B:)
    caefsfhvpsleelagvmqkglkdnfadvqvsvvdcpdltkepftfpvkgicgktriaev
    ggvpyllplvnqkkvydlnkiakeiklpgafilgagagpfqtlgfnsefmpviqtesehk
    ppvngsyfahvnpadggcllekysekchdfqcallanlfasegqpgkvievkakrrtgpl
    nfvtcmretlekhygnkpigmggtfiiqkgkvkshimpaefsscplnsdeevnkwlhfye
    mkaplvclpvfvsrdpgfdlrlehthffsrhgegghyhydttpdiveylgyflpaeflyr
    idqpkethsigrd