PDB entry 1xcq

View 1xcq on RCSB PDB site
Description: Complex HCV core-Fab 19D9D6-Protein L mutant (D55A,L57H,Y64W) in space group P21
Deposited on 2004-09-03, released 2005-05-31
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.195
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoclonal antibody 19D9D6 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (0-219)
  • Chain 'B':
    Compound: Monoclonal antibody 19D9D6 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (0-217)
  • Chain 'C':
    Compound: Monoclonal antibody 19D9D6 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (0-219)
  • Chain 'D':
    Compound: Monoclonal antibody 19D9D6 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (0-217)
  • Chain 'E':
    Compound: Monoclonal antibody 19D9D6 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (0-219)
  • Chain 'F':
    Compound: Monoclonal antibody 19D9D6 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (0-217)
  • Chain 'G':
    Compound: Monoclonal antibody 19D9D6 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (0-End)
  • Chain 'H':
    Compound: Monoclonal antibody 19D9D6 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (0-217)
  • Chain 'L':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ (Start-79)
  • Chain 'M':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ
  • Chain 'N':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ
  • Chain 'O':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XCQ
  • Chain 'P':
    Compound: capsid protein c
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: capsid protein c
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: capsid protein c
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqC (C:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqD (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqE (E:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqF (F:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1xcqG (G:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records):
    >1xcqG (G:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqH (H:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1xcqL (L:)
    mnikfagkektpeepkeevtikvnlifadgkiqtaefkgtfeeataeayryaalhakvng
    ewtadledggnhmnikfagk
    

    Sequence, based on observed residues (ATOM records):
    >1xcqL (L:)
    pkeevtikvnlifadgkiqtaefkgtfeeataeayryaalhakvngewtadledggnhmn
    ikfagk
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1xcqM (M:)
    mnikfagkektpeepkeevtikvnlifadgkiqtaefkgtfeeataeayryaalhakvng
    ewtadledggnhmnikfagk
    

    Sequence, based on observed residues (ATOM records):
    >1xcqM (M:)
    evtikvnlifadgkiqtaefkgtfeeataeayryaalhakvngewtadledggnhmnikf
    ag
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1xcqN (N:)
    mnikfagkektpeepkeevtikvnlifadgkiqtaefkgtfeeataeayryaalhakvng
    ewtadledggnhmnikfagk
    

    Sequence, based on observed residues (ATOM records):
    >1xcqN (N:)
    keevtikvnlifadgkiqtaefkgtfeeataeayryaalhakvngewtadledggnhmni
    kfag
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1xcqO (O:)
    mnikfagkektpeepkeevtikvnlifadgkiqtaefkgtfeeataeayryaalhakvng
    ewtadledggnhmnikfagk
    

    Sequence, based on observed residues (ATOM records):
    >1xcqO (O:)
    evtikvnlifadgkiqtaefkgtfeeataeayryaalhakvngewtadledggnhmnikf
    ag
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1xcqP (P:)
    stnpkpqrktkrntnrrpqdvkfpgggqivggvyllprrgprlg
    

    Sequence, based on observed residues (ATOM records):
    >1xcqP (P:)
    rrpqdvkfpgggqivggvyllprr
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqQ (Q:)
    stnpkpqrktkrntnrrpqdvkfpgggqivggvyllprrgprlg
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >1xcqS (S:)
    stnpkpqrktkrntnrrpqdvkfpgggqivggvyllprrgprlg