PDB entry 1xco

View 1xco on RCSB PDB site
Description: Crystal Structure of a Phosphotransacetylase from Bacillus subtilis in complex with acetylphosphate
Class: transferase
Keywords: STRUCTURAL GENOMICS, BSGC STRUCTURE FUNDED BY NIH, PROTEIN STRUCTURE INITIATIVE, PSI, Berkeley Structural Genomics Center, BSGC, TRANSFERASE
Deposited on 2004-09-02, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.245
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pta, ipa-88d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • cloning artifact (5)
      • initiating methionine (6)
    Domains in SCOPe 2.07: d1xcoa1, d1xcoa2
  • Chain 'B':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pta, ipa-88d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • cloning artifact (5)
      • initiating methionine (6)
    Domains in SCOPe 2.07: d1xcob1, d1xcob2
  • Chain 'C':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pta, ipa-88d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • initiating methionine (6)
    Domains in SCOPe 2.07: d1xcoc_
  • Chain 'D':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pta, ipa-88d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • cloning artifact (4-5)
      • initiating methionine (6)
    Domains in SCOPe 2.07: d1xcod1, d1xcod2
  • Chain 'E':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pta, ipa-88d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • cloning artifact (5)
      • initiating methionine (6)
    Domains in SCOPe 2.07: d1xcoe1, d1xcoe2
  • Chain 'F':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pta, ipa-88d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • initiating methionine (6)
    Domains in SCOPe 2.07: d1xcof_
  • Heterogens: SO4, UVW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xcoA (A:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcoA (A:)
    gmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakake
    lnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykglad
    glvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdla
    eiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqf
    daafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpv
    ndlsrgcnaedvynlalitaaqal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xcoB (B:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcoB (B:)
    gmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakake
    lnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykglad
    glvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdla
    eiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqf
    daafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpv
    ndlsrgcnaedvynlalitaaqal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xcoC (C:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcoC (C:)
    madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
    nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
    lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
    iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
    aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
    dlsrgcnaedvynlalitaaqal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xcoD (D:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcoD (D:)
    ggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakak
    elnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgla
    dglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdl
    aeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefq
    fdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmp
    vndlsrgcnaedvynlalitaaqal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xcoE (E:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcoE (E:)
    gmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakake
    lnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykglad
    glvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdla
    eiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqf
    daafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpv
    ndlsrgcnaedvynlalitaaqal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xcoF (F:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcoF (F:)
    madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
    nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
    lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
    iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
    aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
    dlsrgcnaedvynlalitaaqal