PDB entry 1xcl

View 1xcl on RCSB PDB site
Description: Guanidinoacetate methyltransferase containing S-adenosylhomocysteine and guanidine
Class: transferase
Keywords: Guanidinoacetate methyltransferase, Methyltransferase, S-adenosylhomocysteine, Guanidine, transferase
Deposited on 2004-09-02, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanidinoacetate N-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GAMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10868 (Start-234)
      • see remark 999 (118)
    Domains in SCOPe 2.07: d1xcla_
  • Heterogens: SAH, GAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xclA (A:)
    sssaasplfapgedcgpawraapaaydtsdthlqilgkpvmerwetpymhslaaaaasrg
    grvlevgfgmaiaasrvqqapikehwiiecndgvfqrlqnwalkqphkvvplkglweeva
    ptlpdghfdgilydtyplseetwhthqfnfikthafrllkpggiltycnltswgelmksk
    ytditamfeetqvpalleagfqrenictevmalvppadcryyafpqmitplvtkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xclA (A:)
    plfapgedcgpawraapaaydtsdthlqilgkpvmerwetpymhslaaaaasrggrvlev
    gfgmaiaasrvqqapikehwiiecndgvfqrlqnwalkqphkvvplkglweevaptlpdg
    hfdgilydtyplseetwhthqfnfikthafrllkpggiltycnltswgelmkskytdita
    mfeetqvpalleagfqrenictevmalvppadcryyafpqmitplvtkh