PDB entry 1xch

View 1xch on RCSB PDB site
Description: myoglobin (horse heart) mutant with leu 104 replaced by asn (l104n)
Class: oxygen transport
Keywords: heme, oxygen transport, respiratory protein, muscle
Deposited on 1997-06-06, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
    • engineered (103)
  Domains in SCOPe 2.07: d1xcha_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xchA (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikynefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg