PDB entry 1xcd

View 1xcd on RCSB PDB site
Description: Dimeric bovine tissue-extracted decorin, crystal form 1
Class: structural protein
Keywords: leucine-rich repeat, proteoglycan, structural protein
Deposited on 2004-09-01, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.222
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Decorin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21793
      • see remark 999 (252)
      • see remark 999 (258)
    Domains in SCOPe 2.07: d1xcda_
  • Heterogens: NAG, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xcdA (A:)
    deasgigpeehfpevpeiepmgpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlq
    nnkiteikdgdfknlknlhtlilinnkiskispgafaplvklerlylsknqlkelpekmp
    ktlqelrvheneitkvrksvfnglnqmivvelgtnplkssgiengafqgmkklsyiriad
    tnittipqglppsltelhldgnkitkvdaaslkglnnlaklglsfnsisavdngslantp
    hlrelhlnnnklvkvpggladhkyiqvvylhnnnisaigsndfcppgyntkkasysgvsl
    fsnpvqyweiqpstfrcvyvraavqlgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xcdA (A:)
    gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
    ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
    nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
    nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
    hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
    aavql