PDB entry 1xcc

View 1xcc on RCSB PDB site
Description: 1-Cys peroxidoxin from Plasmodium Yoelli
Class: structural genomics, unknown function
Keywords: UNKNOWN FUNCTION, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2004-09-01, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-Cys peroxiredoxin
    Species: Plasmodium yoelii [TaxId:5861]
    Gene: PY04285
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xcca_
  • Chain 'B':
    Compound: 1-Cys peroxiredoxin
    Species: Plasmodium yoelii [TaxId:5861]
    Gene: PY04285
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xccb_
  • Chain 'C':
    Compound: 1-Cys peroxiredoxin
    Species: Plasmodium yoelii [TaxId:5861]
    Gene: PY04285
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xccc_
  • Chain 'D':
    Compound: 1-Cys peroxiredoxin
    Species: Plasmodium yoelii [TaxId:5861]
    Gene: PY04285
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xccd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xccA (A:)
    mgyhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhed
    flklnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekd
    itglpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwne
    gdkccviptlqddeiskhfkneitkvempskkkylrfvnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xccA (A:)
    gyhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhedf
    lklnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekdi
    tglpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwneg
    dkccviptlqddeiskhfkneitkvempskkkylrfvnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xccB (B:)
    mgyhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhed
    flklnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekd
    itglpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwne
    gdkccviptlqddeiskhfkneitkvempskkkylrfvnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xccB (B:)
    yhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhedfl
    klnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekdit
    glpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwnegd
    kccviptlqddeiskhfkneitkvempskkkylrfvnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xccC (C:)
    mgyhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhed
    flklnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekd
    itglpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwne
    gdkccviptlqddeiskhfkneitkvempskkkylrfvnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xccC (C:)
    yhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhedfl
    klnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekdit
    glpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwnegd
    kccviptlqddeiskhfkneitkvempskkkylrfvnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xccD (D:)
    mgyhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhed
    flklnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekd
    itglpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwne
    gdkccviptlqddeiskhfkneitkvempskkkylrfvnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xccD (D:)
    lgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhedflkl
    nckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekditgl
    pltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwnegdkc
    cviptlqddeiskhfkneitkvempskkkylrfvnl